Prkch Antibody - C-terminal region : Biotin

Prkch Antibody - C-terminal region : Biotin
SKU
AVIARP56704_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 75kDa

Peptide Sequence: Synthetic peptide located within the following region: TPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein kinase C eta type

Protein Size: 683

Purification: Affinity Purified
More Information
SKU AVIARP56704_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56704_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18755
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×