PRPH Antibody - N-terminal region : HRP

PRPH Antibody - N-terminal region : HRP
SKU
AVIARP56707_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the pe

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPH

Key Reference: Xiao,S., (2008) J. Neurosci. 28 (8), 1833-1840

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peripherin

Protein Size: 470

Purification: Affinity Purified
More Information
SKU AVIARP56707_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56707_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5630
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×