PRPSAP2 Antibody - middle region : FITC

PRPSAP2 Antibody - middle region : FITC
SKU
AVIARP56446_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRPSAP2

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: DYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoribosyl pyrophosphate synthase-associated protein 2

Protein Size: 369

Purification: Affinity Purified
More Information
SKU AVIARP56446_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56446_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5636
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×