PRPSAP2 Antibody - N-terminal region : HRP

PRPSAP2 Antibody - N-terminal region : HRP
SKU
AVIARP56445_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRPSAP2

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoribosyl pyrophosphate synthase-associated protein 2

Protein Size: 369

Purification: Affinity Purified
More Information
SKU AVIARP56445_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56445_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5636
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×