PRR18 Antibody - N-terminal region : HRP

PRR18 Antibody - N-terminal region : HRP
SKU
AVIARP55748_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of PRR18 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRR18

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proline-rich protein 18

Protein Size: 295

Purification: Affinity Purified
More Information
SKU AVIARP55748_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55748_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285800
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×