PRR30 Antibody - middle region : Biotin

PRR30 Antibody - middle region : Biotin
SKU
AVIARP55780_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C2orf53

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: PQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRSAGLQSPNSPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: proline-rich protein 30

Protein Size: 412

Purification: Affinity Purified
More Information
SKU AVIARP55780_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55780_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 339779
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×