PRSS21 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS21

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testisin

Protein Size: 300

Purification: Affinity Purified

• SKU: AVIARP53665_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53665_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10942
• Host: Rabbit
• Conjugate: Conjugated, HRP