PRSS22 Antibody - N-terminal region : HRP

PRSS22 Antibody - N-terminal region : HRP
SKU
AVIARP57603_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the trypsin family of serine proteases. The enzyme is expressed in the airways in a developmentally regulated manner. The gene is part of a cluster of serine protease genes on chromosome 16.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS22

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Brain-specific serine protease 4

Protein Size: 317

Purification: Affinity Purified
More Information
SKU AVIARP57603_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57603_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64063
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×