PRUNE1 Antibody - C-terminal region : FITC

PRUNE1 Antibody - C-terminal region : FITC
SKU
AVIARP57538_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the DHH protein superfamily of phosphoesterases. This protein has been found to function as both a nucleotide phosphodiesterase and an exopolyphosphatase. This protein is believed to stimulate cancer progression and metastases through the induction of cell motility. A pseuodgene has been identified on chromosome 13. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PRUNE

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: exopolyphosphatase PRUNE1

Protein Size: 241

Purification: Affinity Purified
More Information
SKU AVIARP57538_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57538_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 58497
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×