Psma2 Antibody - C-terminal region : HRP

Psma2 Antibody - C-terminal region : HRP
SKU
AVIARP56454_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Psma2 is a component of the proteasome multicatalytic proteinase complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proteasome subunit alpha type-2

Protein Size: 234

Purification: Affinity Purified

Subunit: alpha type-2
More Information
SKU AVIARP56454_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56454_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29669
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×