PSMA5 Antibody - middle region : HRP

PSMA5 Antibody - middle region : HRP
SKU
AVIARP56456_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSMA5

Key Reference: Beausoleil,S.A., (2006) Nat. Biotechnol. 24 (10), 1285-1292

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Proteasome subunit alpha type-5

Protein Size: 241

Purification: Affinity Purified

Subunit: alpha type-5
More Information
SKU AVIARP56456_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56456_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5686
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×