PSMD3 Antibody - N-terminal region : Biotin

PSMD3 Antibody - N-terminal region : Biotin
SKU
AVIARP56479_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 26S proteasome non-ATPase regulatory subunit 3

Protein Size: 534

Purification: Affinity Purified

Subunit: 3
More Information
SKU AVIARP56479_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56479_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5709
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×