PTGES3 Antibody - middle region : Biotin

PTGES3 Antibody - middle region : Biotin
SKU
AVIARP58319_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTGES3

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostaglandin E synthase 3

Protein Size: 160

Purification: Affinity Purified
More Information
SKU AVIARP58319_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58319_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10728
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×