PTK6 Antibody - middle region : HRP

PTK6 Antibody - middle region : HRP
SKU
AVIARP56657_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epi

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTK6

Key Reference: Lukong,K.E. (2008) Cell. Signal. 20 (2), 432-442

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein-tyrosine kinase 6

Protein Size: 451

Purification: Affinity Purified
More Information
SKU AVIARP56657_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56657_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5753
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×