PTPN22 Antibody - middle region : Biotin

PTPN22 Antibody - middle region : Biotin
SKU
AVIARP54896_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PTPN22

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tyrosine-protein phosphatase non-receptor type 22

Protein Size: 563

Purification: Affinity Purified
More Information
SKU AVIARP54896_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54896_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26191
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×