PTS Antibody - N-terminal region : FITC

PTS Antibody - N-terminal region : FITC
SKU
AVIARP56099_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The enzyme encoded by this gene catalyzes the elimination of inorganic triphosphate from dihydroneopterin triphosphate, which is the second and irreversible step in the biosynthesis of tetrahydrobiopterin from GTP. Tetrahydrobiopterin, also known as BH(4), is an essential cofactor and regulator of various enzyme activities, including enzymes involved in serotonin biosynthesis and NO synthase activity. Mutations in this gene result in hyperphenylalaninemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PTPS

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: SKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-pyruvoyl tetrahydrobiopterin synthase

Protein Size: 145

Purification: Affinity Purified
More Information
SKU AVIARP56099_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56099_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5805
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×