PTX3 Antibody - N-terminal region : HRP

PTX3 Antibody - N-terminal region : HRP
SKU
AVIARP56497_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PTX3 plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PTX3

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pentraxin-related protein PTX3

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP56497_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56497_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5806
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×