PXT1 Antibody - middle region : HRP

PXT1 Antibody - middle region : HRP
SKU
AVIARP55566_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of PXT1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PXT1

Key Reference: Grzmil,P., Cytogenet. Genome Res. 119 (1-2), 74-82 (2007)

Molecular Weight: 6kDa

Peptide Sequence: Synthetic peptide located within the following region: MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peroxisomal testis-specific protein 1

Protein Size: 51

Purification: Affinity Purified
More Information
SKU AVIARP55566_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55566_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 222659
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×