PYCR1 Antibody - middle region : FITC

PYCR1 Antibody - middle region : FITC
SKU
AVIARP57750_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR1

Key Reference: Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyrroline-5-carboxylate reductase 1, mitochondrial

Protein Size: 316

Purification: Affinity Purified
More Information
SKU AVIARP57750_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57750_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5831
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×