PYCR1 Antibody - middle region : HRP

PYCR1 Antibody - middle region : HRP
SKU
AVIARP57750_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. The protein forms a homopolymer and localizes

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR1

Key Reference: Meng,Z., (2006) J. Mol. Biol. 359 (5), 1364-1377

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyrroline-5-carboxylate reductase 1, mitochondrial

Protein Size: 316

Purification: Affinity Purified
More Information
SKU AVIARP57750_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57750_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5831
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×