PYCR2 Antibody - middle region : HRP

PYCR2 Antibody - middle region : HRP
SKU
AVIARP54937_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PYCR2 belongs to the pyrroline-5-carboxylate reductase family. The function of the PYCR2 protein is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PYCR2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyrroline-5-carboxylate reductase 2

Protein Size: 320

Purification: Affinity Purified
More Information
SKU AVIARP54937_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54937_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Immunoprecipitation, Western Blotting, Immunohistochemistry
Human Gene ID 29920
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×