PYDC1 Antibody - N-terminal region : FITC

PYDC1 Antibody - N-terminal region : FITC
SKU
AVIARP55560_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PYDC1 associates with apoptosis-associated specklike protein containing a CARD domain (ASC) and modulates its ability to collaborate with pyrin and cryopyrin in NF-kappa-B and pro- caspase-1 activation. It suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PYDC1

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: REAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyrin domain-containing protein 1

Protein Size: 89

Purification: Affinity Purified
More Information
SKU AVIARP55560_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55560_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 260434
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×