PYDC1 Antibody - N-terminal region : HRP

PYDC1 Antibody - N-terminal region : HRP
SKU
AVIARP55560_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PYDC1 associates with apoptosis-associated specklike protein containing a CARD domain (ASC) and modulates its ability to collaborate with pyrin and cryopyrin in NF-kappa-B and pro- caspase-1 activation. It suppresses kinase activity of NF-kappa-B inhibitor kinase (IKK) complex, expression of NF-kappa-B inducible genes and inhibits NF-kappa-B activation by cytokines and LPS.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PYDC1

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: REAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyrin domain-containing protein 1

Protein Size: 89

Purification: Affinity Purified
More Information
SKU AVIARP55560_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55560_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 260434
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×