R3HDM2 Antibody - middle region : FITC

R3HDM2 Antibody - middle region : FITC
SKU
AVIARP55106_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human R3HDM2

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: R3H domain-containing protein 2

Protein Size: 637

Purification: Affinity Purified
More Information
SKU AVIARP55106_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55106_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22864
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×