Clone Name: 4H9
Application Note: WB: 0.25-0.5 μg/ml. ICC/IF: 5 μg/ml. IHC-P: 2-5 μg/ml. FCM: 1-3 μg/1x10⁶cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.
Calculated MW: 24
Form: Liquid
Buffer (with preservative): 4mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, no preservative.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]
Uniprot ID: P62491
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: RAB11A, member RAS oncogene family