RAB11FIP2 Antibody - N-terminal region : Biotin

RAB11FIP2 Antibody - N-terminal region : Biotin
SKU
AVIARP55095_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB11FIP2

Molecular Weight: 58

Peptide Sequence: Synthetic peptide located within the following region: LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rab11 family-interacting protein 2

Protein Size: 512

Purification: Affinity Purified
More Information
SKU AVIARP55095_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55095_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22841
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×