Rab17 Antibody - N-terminal region : HRP

Rab17 Antibody - N-terminal region : HRP
SKU
AVIARP57631_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rab17 might be involved in transcellular transport.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rab17

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: GSSSLKLEIWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-17

Protein Size: 214

Purification: Affinity Purified
More Information
SKU AVIARP57631_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57631_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 19329
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×