RAB21 Antibody - C-terminal region : Biotin

RAB21 Antibody - C-terminal region : Biotin
SKU
AVIARP55140_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB21

Key Reference: N/A

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-21

Protein Size: 225

Purification: Affinity purified
More Information
SKU AVIARP55140_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55140_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23011
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×