RAB21 Antibody - C-terminal region : HRP

RAB21 Antibody - C-terminal region : HRP
SKU
AVIARP55140_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to the Rab family of monomeric GTPases, which are involved in the control of cellular membrane traffic. The encoded protein plays a role in the targeted trafficking of integrins via its association with integrin alpha tails. As a consequence, the encoded protein is involved in the regulation of cell adhesion and migration.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB21

Key Reference: N/A

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: SYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-21

Protein Size: 225

Purification: Affinity purified
More Information
SKU AVIARP55140_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55140_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23011
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×