RAB23 Antibody - N-terminal region : Biotin

RAB23 Antibody - N-terminal region : Biotin
SKU
AVIARP56870_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It may be involved in small GTPase mediated signal transduction and intracellular protein transportation. Alternative splicing occurs at this locus and two transcript va

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB23

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-23

Protein Size: 237

Purification: Affinity Purified
More Information
SKU AVIARP56870_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56870_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51715
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×