Rab27a Antibody - middle region : Biotin

Rab27a Antibody - middle region : Biotin
SKU
AVIARP56564_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rab27a plays a role in cytotoxic granule exocytosis in lymphocytes. It is required for both granule maturation and granule docking and priming at the immunologic synapse.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP56564_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56564_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11891
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×