Rab27a Antibody - middle region : HRP

Rab27a Antibody - middle region : HRP
SKU
AVIARP56564_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rab27a plays a role in cytotoxic granule exocytosis in lymphocytes. It is required for both granule maturation and granule docking and priming at the immunologic synapse.

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP56564_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56564_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11891
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×