RAB37 Antibody - middle region : Biotin

RAB37 Antibody - middle region : Biotin
SKU
AVIARP55738_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB37

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: ERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-37

Protein Size: 216

Purification: Affinity Purified
More Information
SKU AVIARP55738_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55738_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 326624
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×