RAB3IL1 Antibody - middle region : Biotin

RAB3IL1 Antibody - middle region : Biotin
SKU
AVIARP56739_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RAB3IL1 is a guanine nucleotide exchange factor (GEF) for Rab3A, a GTPase that regulates synaptic vesicle exocytosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB3IL1

Key Reference: Krull,M., (2005) Mol. Biol. Evol. 22 (8), 1702-1711

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Guanine nucleotide exchange factor for Rab-3A

Protein Size: 382

Purification: Affinity Purified
More Information
SKU AVIARP56739_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56739_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5866
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×