RAC1 Antibody - middle region : Biotin

RAC1 Antibody - middle region : Biotin
SKU
AVIARP57798_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAC1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related C3 botulinum toxin substrate 1

Protein Size: 192

Purification: Affinity Purified
More Information
SKU AVIARP57798_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57798_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5879
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×