Rad21 Antibody - N-terminal region : Biotin

Rad21 Antibody - N-terminal region : Biotin
SKU
AVIARP56709_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: EDDDMLVSTSASNLLLEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Rad21 Ensembl ENSRNOP00000006209

Protein Size: 635

Purification: Affinity Purified
More Information
SKU AVIARP56709_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56709_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 314949
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×