RAGE Antibody - N-terminal region : FITC

RAGE Antibody - N-terminal region : FITC
SKU
AVIARP56743_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAGE is able to phosphorylate several exogenous substrates and to undergo autophosphorylation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAGE

Key Reference: Luo,H.R., (2001) Neuron 31 (3), 439-451

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAPK/MAK/MRK overlapping kinase

Protein Size: 419

Purification: Affinity Purified
More Information
SKU AVIARP56743_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56743_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5891
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×