Rala Antibody - N-terminal region : Biotin

Rala Antibody - N-terminal region : Biotin
SKU
AVIARP56642_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rala is a putative GTP binding protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rala

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Ral-A

Protein Size: 206

Purification: Affinity Purified
More Information
SKU AVIARP56642_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56642_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 81757
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×