RALGDS Antibody - N-terminal region : Biotin

RALGDS Antibody - N-terminal region : Biotin
SKU
AVIARP56275_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RALGDS

Key Reference: Omholt,K. (2007) Melanoma Res. 17 (6), 410-412

Molecular Weight: 95kDa

Peptide Sequence: Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ral guanine nucleotide dissociation stimulator

Protein Size: 859

Purification: Affinity Purified
More Information
SKU AVIARP56275_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56275_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5900
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×