Rangap1 Antibody - N-terminal region : Biotin

Rangap1 Antibody - N-terminal region : Biotin
SKU
AVIARP56510_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: AAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGIIGTLEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rangap1 protein EMBL AAH14855.1

Protein Size: 589

Purification: Affinity Purified
More Information
SKU AVIARP56510_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56510_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 19387
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×