Rap1a Antibody - middle region : Biotin

Rap1a Antibody - middle region : Biotin
SKU
AVIARP56195_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rap1a induces morphological reversion of a cell line transformed by a Ras oncogene. Rap1a counteracts the mitogenic function of Ras, at least partly because it can interact with Ras GAPs and RAF in a competitive manner.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Rap1a

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: DLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rap-1A

Protein Size: 184

Purification: Affinity Purified
More Information
SKU AVIARP56195_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56195_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 109905
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×