RAP1GAP Antibody - middle region : FITC

RAP1GAP Antibody - middle region : FITC
SKU
AVIARP56512_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: TWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rap1 GTPase-activating protein 1

Protein Size: 663

Purification: Affinity Purified
More Information
SKU AVIARP56512_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56512_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5909
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×