RAPGEF1 Antibody - C-terminal region : FITC

RAPGEF1 Antibody - C-terminal region : FITC
SKU
AVIARP54753_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAPGEF1 is a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade protein may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation.This gene encodes a human guanine nucleotide exchange factor. It transduces signals from CRK by binding the SH3 domain of CRK, and activating several members of the Ras family of GTPases. This signaling cascade that may be involved in apoptosis, integrin-mediated signal transduction, and cell transformation. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAPGEF1

Key Reference: Niclas,J., (2007) Exp. Cell Res. 313 (18), 3881-3891

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: LWAKEQNEEKSPNLTQFTEHFNNMSYWVRSIIMLQEKAQDRERLLLKFIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rap guanine nucleotide exchange factor 1

Protein Size: 1077

Purification: Affinity Purified
More Information
SKU AVIARP54753_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54753_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2889
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×