RASGEF1C Antibody - middle region : HRP

RASGEF1C Antibody - middle region : HRP
SKU
AVIARP55737_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RASGEF1C is the guanine nucleotide exchange factor (GEF).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RASGEF1C

Key Reference: Bonaldo,M.F., (1996) Genome Res. 6 (9), 791-806

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-GEF domain-containing family member 1C

Protein Size: 466

Purification: Affinity Purified
More Information
SKU AVIARP55737_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55737_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 255426
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×