RASGRF1 Antibody - N-terminal region : FITC

RASGRF1 Antibody - N-terminal region : FITC
SKU
AVIARP56516_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) similar to the Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated that this protein stimulates the dissociation of GDP from RAS protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRF1

Key Reference: Iguchi,T., (2007) Int. J. Oncol. 31 (2), 285-291

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-specific guanine nucleotide-releasing factor 1

Protein Size: 489

Purification: Affinity Purified

Specificity#: Predicted to recognized both human RASGRF1 isoforms (145, 55kD)
More Information
SKU AVIARP56516_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56516_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5923
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×