RBJ Antibody - middle region : HRP

RBJ Antibody - middle region : HRP
SKU
AVIARP56938_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBJ

Key Reference: von (2004) Gene 327 (2), 221-232

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DnaJ homolog subfamily C member 27

Protein Size: 273

Purification: Affinity Purified
More Information
SKU AVIARP56938_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56938_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51277
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×