RD3 Antibody - N-terminal region : Biotin

RD3 Antibody - N-terminal region : Biotin
SKU
AVIARP55856_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RD3

Key Reference: Friedman,J.S., (2006) Am. J. Hum. Genet. 79 (6), 1059-1070

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RD3

Protein Size: 195

Purification: Affinity Purified
More Information
SKU AVIARP55856_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55856_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 343035
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×