Recombinant Human ABCB7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75027

Gene Name: ABCB7

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Tyr481

End Site: Ile740

Coverage: 0.38

Isoelectric Point: 7

Core Sequence: YIEGQKVLSGISFEVPAGKKVAIVGGSGSGKSTIVRLLFRFYEPQKGSIYLAGQNIQDVSLESLRRAVGVVPQDAVLFHNTIYYNLLYGNISASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLSGGEKQRVAIARAILKDPPVILYDEATSSLDSITEETILGAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 95%

Alternative gene names: ABC7

Alternative protein names: Iron-sulfur clusters transporter ABCB7; mitochondrial; ATP-binding cassette sub-family B member 7; mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein

Protein name: ATP binding cassette subfamily B member 7

Full length: 752 amino acids

Entry name: ABCB7_HUMAN

• SKU: ASBPP-3770-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3770-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 22