Recombinant Human ABRAXAS1 Protein

Recombinant Human ABRAXAS1 Protein
SKU
ASBPP-3088-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6UWZ7

Gene Name: ABRAXAS1

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Ser11

End Site: Ile270

Coverage: 0.67

Isoelectric Point: 7.5

Core Sequence: SGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 79%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: ABRA1; CCDC98; FAM175A

Alternative protein names: BRCA1-A complex subunit Abraxas 1; Coiled-coil domain-containing protein 98; Protein FAM175A

Protein name: abraxas 1, BRCA1 A complex subunit

Full length: 409 amino acids

Entry name: ABRX1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3088-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3088-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 84142
Product information (PDF)
×
MSDS (PDF)
×