Note: Dry Ice fees will be extra-charged
Uniprot: Q6UWZ7
Gene Name: ABRAXAS1
Expression System: Escherichia coli
Molecular Weight: 32.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 79%
Start Site: Ser11
End Site: Ile270
Coverage: 0.67
Isoelectric Point: 7.5
Core Sequence: SGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNI
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 79%, Pig - 91%, Cynomolgus monkey - 99%
Alternative gene names: ABRA1; CCDC98; FAM175A
Alternative protein names: BRCA1-A complex subunit Abraxas 1; Coiled-coil domain-containing protein 98; Protein FAM175A
Protein name: abraxas 1, BRCA1 A complex subunit
Full length: 409 amino acids
Entry name: ABRX1_HUMAN
Product panel: DNA binding & Chromatin
English
Deutsch
